The short version of actin-binding motif fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2025-09-12. Anything still debated is marked as such rather than presented as settled.
Material sold under this label typically arrives as a freeze-dried powder in a sealed vial with a certificate of analysis. Such certificates usually report reversed-phase chromatography purity plus a mass confirmation, and stated purities commonly sit between 95 and 99 percent. Counter-ion identity, residual trifluoroacetate, water content, and peptide net weight are separate specifications that a certificate may or may not include. A purity figure alone does not establish sequence identity, so independent mass verification remains the practical check.
The designation TB-500 circulates in laboratory and catalog contexts without a single agreed definition. Most product listings apply it to an N-terminally acetylated seven-residue fragment of thymosin beta-4, while other listings attach the same label to the full 43-residue protein. Because the term is commercial rather than systematic, two entries bearing identical names may describe different molecules. Any documentation should therefore state which sequence a given sample is claimed to contain.
Peptide bonds are susceptible to hydrolysis under extreme pH and to enzymatic cleavage if proteases are present. Heat, oxidising agents, and prolonged exposure to light also contribute to loss of material. Aggregation can occur at high concentrations or in certain buffer systems, and it may not be visible to the eye. Storage at -20 C or below is typical for both powder and aliquoted solutions, and desiccation of the powder is preferred.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography together with mass spectrometry. The chromatogram provides a purity estimate as a percentage of total peak area, while the mass spectrum confirms that the observed mass matches the expected value. Amino acid analysis or tandem mass spectrometry sequencing can provide additional confirmation. Reported purity figures depend on the column, gradient, and detection wavelength, so values from different laboratories are not directly comparable without method details.
| Property | Value | Notes |
|---|---|---|
| Molecular mass | ≈889 Da for the 7-residue fragment | Full-length thymosin beta-4 is ≈4.9 kDa; catalogs differ |
| Appearance | White to off-white powder | Hygroscopic; weight shifts with residual moisture |
| Solubility class | Freely soluble in water | Also dissolves in aqueous buffers; poorly soluble in nonpolar solvents |
| Typical storage temperature | −20 °C, desiccated, protected from light | Once rehydrated, short-term holding at 2-8 °C |
| Typical analytical method | Reversed-phase HPLC with mass spectrometry | Purity by UV absorbance; identity by ESI-MS or MALDI-TOF |
Regulatory status differs by country, but TB-500 is not an approved pharmaceutical in major jurisdictions. It is commonly sold as a research chemical for laboratory use, which places responsibility for identity and purity on the supplier and the laboratory. Published human data are limited, and most reports involve preclinical models or cell culture. Questions about whether the fragment mimics all actions of thymosin beta-4, and under which conditions, remain open. Independent verification of any material is therefore a practical requirement in research settings.
TB-500 is a synthetic heptapeptide with the sequence Ac-LKKTETQ. It corresponds to a short N-terminal region of thymosin beta-4, a 43-amino-acid protein found in many cell types. The fragment contains an actin-binding motif, which is one reason it appears in laboratory studies of cell migration and cytoskeletal dynamics. TB-500 is not the full-length protein and is produced as a research chemical rather than an approved therapeutic agent. Its molecular weight is approximately 889 Da.
Purity and identity are separate measurements and are often confused. Reverse-phase high-performance liquid chromatography, usually with ultraviolet detection near 214 nanometres, reports the share of total peak area belonging to the target compound. Mass spectrometry by electrospray or matrix-assisted laser desorption then checks whether the observed mass matches the expected sequence. Neither measurement alone shows that a vial holds the intended peptide. Peptide content, meaning the fraction of vial mass that is genuine peptide rather than counter-ion, water or residual acid, is reported separately and is frequently lower than the stated purity figure.
The regulatory position is broadly consistent across major jurisdictions: no thymosin beta-4 fragment is an approved medicine, and laboratory material is commonly labelled as not intended for human consumption. Anti-doping rules in sport list thymosin beta-4 and its fragments among prohibited peptide hormones. Because these products travel through research-chemical channels rather than pharmaceutical supply chains, quality varies considerably between vendors. Independent testing of identity, purity and sterility is the only dependable check, and a certificate of analysis describes one batch rather than a supplier's whole catalogue.
TB-500 is a synthetic peptide preparation marketed under a name derived from thymosin beta-4, a 43-residue actin-binding protein first isolated from thymus tissue. The full-length protein has a reported molecular mass near 4963 Da, while material sold as TB-500 is often described as a fragment containing the actin-binding motif LKKTETQ. Because suppliers use the name inconsistently, published sources sometimes refer to the same label as a fragment, a synthetic copy, or a related analog. This naming ambiguity complicates direct comparison of reports across studies.
Laboratory work on thymosin beta-4 describes binding to monomeric actin and effects on cell migration, angiogenesis, and inflammatory signaling in cultured cells. Animal models have examined skin, corneal, and cardiac repair after injury, with outcomes reported mainly in preclinical literature. Most of that evidence concerns the parent protein rather than preparations labelled TB-500, so extrapolation from animal findings to a specific commercial product remains uncertain. Whether the two behave identically in living systems has not been established in controlled human studies.
TB-500 is a research peptide whose sequence matches residues 17 to 23 of thymosin beta-4, a 43-residue protein present in most mammalian cells. The chain is seven amino acids long, written as LKKTETQ, and is normally supplied with an acetyl group on the N-terminus. Suppliers list it as a lyophilised powder under the code name TB-500, and the same sequence appears elsewhere in catalogues as the thymosin beta-4 actin-binding fragment. The label is commercial rather than systematic, so no single authority fixes exactly what TB-500 denotes.
Thymosin beta-4 was isolated from calf thymus in the early 1980s and later characterised as an abundant intracellular actin-sequestering protein. Interest in short synthetic fragments grew once the actin-binding motif had been mapped to the middle of the sequence. TB-500 came out of that line of work as a truncated analogue rather than a natural isolate, and it is now sold mainly to laboratories. Published studies on the fragment have been largely in vitro or in animal models, and controlled human trials remain sparse, so claims about effects in people rest on extrapolation.
Literature and online discussion often conflate TB-500 with full-length thymosin beta-4, even though the two differ in size and are not interchangeable in analytical terms. The fragment is produced by solid-phase peptide synthesis, and the product is a defined seven-residue chain rather than a biological extract. Because the term is a trade-style label, two vendors may supply materials of the same nominal sequence but different counter-ion content, purity, or water content. Comparisons across studies are therefore difficult unless the exact sequence and purity are reported.
== Units of measurement == When referring to dietary allowances or nutritional science, retinol is usually measured in international units (IU). IU refers to biological activity and therefore is unique to each individual compound, however, 1 IU of retinol is equivalent to approximately 0.3 micrograms (300 nanograms).
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Eosinophilic cutaneous conditions encompass a wide variety of diseases that are characterized histologically by the presence of eosinophils in the inflammatory infiltrate, or evidence of eosinophil degranulation.
The reference values vary across studies, ranging from > 25 cm/s to > 35 cm/s. Values above 35 cm/s indicate the absence of arterial disease, values below 25 cm/s indicate arterial insufficiency, and values of 25–35 cm/s are indeterminate because they are less specific (see image below). The data obtained should be correlated with the degree of erection observed. If the peak systolic velocities are normal, the final diastolic velocities should be evaluated, those above 5 cm/s being associated with venogenic ED.
Sources: en.wikipedia.org
== External links == WHO Good Clinical Laboratory Practice (GCLP) (11 Oct 2010) MHRA guidance on the maintenance of regulatory compliance in laboratories that perform the analysis or evaluation of clinical trial samples (11 Oct 2010)
== Early life == He was born in Fort Worth, Texas, on 15 July 1921, the only son of George E. Merrifield and Lorene née Lucas. In 1923 the family moved to California where he attended nine grade schools and two high schools before graduating from Montebello High School in 1939. It was there that he developed an interest both in chemistry and in astronomy. After two years at Pasadena Junior College he transferred to the University of California at Los Angeles (UCLA). After graduation in chemistry he worked for a year at the Philip R. Park Research Foundation taking care of an animal colony and assisting with growth experiments on synthetic amino acid diets. One of these was the experiment by Geiger using the law of the minimum that first demonstrated that the essential amino acids must be present simultaneously for growth to occur. He returned to graduate school at the UCLA chemistry department with professor of biochemistry M.S. Dunn to develop microbiological methods for the quantitation of the pyrimidines. The day after graduating on 19 June 1949, he married Elizabeth Furlong and the next day left for New York City and the Rockefeller Institute for Medical Research.
The initial therapeutic effects of atomoxetine usually take 1 to 4 weeks to become apparent. A further 2 to 4 weeks may be required for the full therapeutic effects to be seen. Incrementally increasing response may occur up to 1 year or longer. The maximum recommended total daily dose in children and adolescents is 70 mg and adults is 100 mg.
Telisotuzumab vedotin, sold under the brand name Emrelis, is an antibody drug conjugate used for the treatement of non-small cell lung cancer. Telisotuzumab vedotin is a c-Met-directed antibody and microtubule inhibitor conjugate. It was developed by AbbVie. The most common adverse reactions include peripheral neuropathy, fatigue, decreased appetite, and peripheral edema. The most common grade 3 or 4 laboratory abnormalities include decreased lymphocytes, increased glucose, increased alanine aminotransferase, increased gamma glutamyl transferase, decreased phosphorus, decreased sodium, decreased hemoglobin, and decreased calcium. Telisotuzumab vedotin was approved for medical use in the United States in May 2025. The US Food and Drug Administration considers it to be a first-in-class medication.
The adaptor hypothesis is a theoretical scheme in molecular biology to explain how information encoded in the nucleic acid sequences of messenger RNA (mRNA) is used to specify the amino acids that make up proteins during the process of translation. It was formulated by Francis Crick in 1955 in an informal publication of the RNA Tie Club, and later elaborated in 1957 along with the central dogma of molecular biology and the sequence hypothesis. It was formally published as an article "On protein synthesis" in 1958. The name "adaptor hypothesis" was given by Sydney Brenner. Crick postulated that there must exist a small molecule to precisely recognise and bind the mRNA sequences while amino acids are being synthesised. The hypothetical adaptor molecule was later established to be a hitherto unknown nucleic acid, transfer RNA (tRNA).
Sources: en.wikipedia.org
This meeting had been approved at the highest levels of both governments because each side had something the other wanted very badly: the Soviets wanted to know exactly why Boeing had put the 747 engines in under-wing pods instead of at the rear of the fuselage, while Withington and the Boeing engineers had a long list of questions about the processing and use of titanium in airframes (at the time Boeing badly needed this for their proposed Boeing 2707 SST, at Mach 3 too fast and hot for Concorde-style aluminium, and the Soviets then led the world in titanium technology). According to Sutter's account, both sides left the meeting well satisfied with the exchange of information. It seems (again according to Sutter's account of the aftermath) that this meeting may have made a real difference to Soviet aircraft design, but Boeing's contribution could naturally not be acknowledged publicly by the Soviet side. Ilyushin therefore had to stress that it had been the first in the world to use podded engines suspended from pylons beneath and ahead of the wing, on the experimental Ilyushin Il-22 four-engined jet bomber of 1946 (first use of this designation). Having thus presented the Il-86's ultimate configuration as indigenously Soviet, the bureau could at last show it in public in 1973, six years after publication of the aerobus specification and four years after the design assignment. A modern six-window flightdeck followed, in place of the 18-to-20 window glazing of the Il-18, Il-62 and Il-76. The main problem facing the Il-86 project was the lack of a suitable engine.
UDP-N-acetyl-D-glucosamine + [protein]-L-serine → UDP + [protein]-3-O-(N-acetyl-D-glucosaminyl)-L-serine UDP-N-acetyl-D-glucosamine + [protein]-L-threonine → UDP + [protein]-3-O-(N-acetyl-D-glucosaminyl)-L-threonine First, the hydroxyl group of serine is deprotonated by histidine 498, a catalytic base in this proposed reaction. Lysine 842 is also present to stabilize the UDP moiety. The oxygen ion then attacks the sugar-phosphate bond between the glucosamine and UDP. This results in the splitting of UDP-N-acetylglucosamine into N-acetylglucosamine – peptide and UDP. Proton transfers take place at the phosphate and histidine 498. This mechanism is spurred by OGT gene containing O-linked N-acetylglucosamine transferase. Aside from proton transfers the reaction proceeds in one step, as shown in Figure 2. Figure 2 uses a lone serine residue as a representative of the peptide with a reactive hydroxyl group. Threonine could have also been used in the mechanism.
Architecture The topic of the origin of Romanian culture began to be discussed by the end of the 18th century among the Transylvanian School scholars. Several writers rose to prominence in the 19th century, including: George Coșbuc, Ioan Slavici, Mihail Kogălniceanu, Vasile Alecsandri, Nicolae Bălcescu, Ion Luca Caragiale, Ion Creangă, and Mihai Eminescu, the later being considered the greatest and most influential Romanian poet, particularly for the poem Luceafărul. In the 20th century, a number of Romanian artists and writers achieved international acclaim, including: Tristan Tzara, Marcel Janco, Mircea Eliade, Nicolae Grigorescu, Marin Preda, Liviu Rebreanu, Eugène Ionesco, Emil Cioran, and Constantin Brâncuși. Brâncuși has a sculptural ensemble in Târgu Jiu, while his sculpture Bird in Space, was auctioned in 2005 for $27.5 million. Romanian-born Holocaust survivor Elie Wiesel received the Nobel Peace Prize in 1986, while Banat Swabian writer Herta Müller received the 2009 Nobel Prize in Literature.
Around the end of the 16th century, increasing Cossack aggression strained relations between the Commonwealth and the Ottoman Empire. Cossacks had begun raiding Ottoman territories during the second part of the 16th century. The Polish government could not control them, but was held responsible as the men were nominally its subjects. In retaliation, Tatars living under Ottoman rule launched raids into the Commonwealth, mostly in the southeast territories. Cossack pirates responded by raiding wealthy trading port-cities in the heart of the Ottoman Empire, as these were just two days away by boat from the mouth of the Dnieper river. In 1615 and 1625, Cossacks razed suburbs of Constantinople, forcing the Ottoman Sultan to flee his palace. In 1637, the Zaporozhian Cossacks, joined by the Don Cossacks, captured the strategic Ottoman fortress of Azov, which guarded the Don. The Zaporizhian Cossacks became particularly strong in the first quarter of the 17th century under the leadership of hetman Petro Konashevych-Sahaidachny, who launched successful campaigns against the Tatars and Turks. Tsar Boris Godunov had incurred the hatred of Ukrainian Cossacks by ordering the Don Cossacks to drive away from the Don all the Ukrainian Cossacks fleeing the failed uprisings of the 1590s. This contributed to the Ukrainian Cossacks' willingness to fight against him. In 1604, 2,000 Zaporizhian Cossacks fought on the side of the Polish-Lithuanian Commonwealth and their proposal for the Tsar (Dmitri I), against the Muscovite army.
Sources: en.wikipedia.org
Usually not, though usage overlaps. The label most often refers to a short acetylated fragment of the parent protein, while thymosin beta-4 itself is the full 43-residue molecule. Because suppliers vary, a sequence statement is needed to settle the question for any particular lot.
The name is a commercial label rather than a systematic chemical designation, so different vendors and papers attach it to different sequences. Some treat it as a fragment and others as the whole protein. Comparing two reports therefore requires checking what each one actually analyzed.
Typically it reflects the relative area of the main peak in a reversed-phase chromatogram at a given wavelength. It does not confirm the amino acid sequence, the counter-ion, or the amount of peptide by mass. Identity is normally established by a separate mass measurement.
The lyophilised powder is typically held at -20 C or lower in a dry, dark place. Reconstituted solutions are aliquoted and frozen to avoid repeated freeze-thaw cycles.