Ac-SDKP comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2026-04-29. Numbers and descriptions here follow the published literature rather than marketing material.
Several names appear in scientific and commercial contexts for this peptide. The label TB-500 is informal and does not follow standard biochemical nomenclature. Research articles more often describe the compound as a thymosin beta-4 fragment, Tβ4 fragment, or by its sequence Ac-LKKTETQ. Confusing TB-500 with full-length thymosin beta-4 can lead to incorrect assumptions about activity because the fragment lacks the remaining residues of the parent protein. The relationship between fragment and parent protein remains an active area of study.
Regulatory status differs by country, but TB-500 is not an approved pharmaceutical in major jurisdictions. It is commonly sold as a research chemical for laboratory use, which places responsibility for identity and purity on the supplier and the laboratory. Published human data are limited, and most reports involve preclinical models or cell culture. Questions about whether the fragment mimics all actions of thymosin beta-4, and under which conditions, remain open. Independent verification of any material is therefore a practical requirement in research settings.
TB-500 is a synthetic heptapeptide with the sequence Ac-LKKTETQ. It corresponds to a short N-terminal region of thymosin beta-4, a 43-amino-acid protein found in many cell types. The fragment contains an actin-binding motif, which is one reason it appears in laboratory studies of cell migration and cytoskeletal dynamics. TB-500 is not the full-length protein and is produced as a research chemical rather than an approved therapeutic agent. Its molecular weight is approximately 889 Da.
Material is normally supplied as a lyophilised powder in a sealed vial. The powder is hygroscopic, so exposure to humid air leads to water uptake, caking and gradual loss of the fluffy texture that indicates a good freeze-dry. Vials are best kept sealed with desiccant, protected from light and stored cold. Letting a cold vial warm to room temperature before opening reduces condensation on the contents. Purity is normally reported from a chromatographic run, and that figure applies to the batch as tested rather than to the vial after repeated opening.
Once dissolved, the peptide is far less stable than the dry powder. Aqueous solutions are subject to hydrolysis, oxidation at susceptible residues and gradual loss of material through adsorption onto glass and plastic surfaces. Terminal glutamine can cyclise under some conditions, producing a related species that complicates purity assessment. Dilute solutions tend to lose a larger fraction of material to surfaces than concentrated ones. Buffers, pH and ionic strength all influence the rate of change, so stability figures are only meaningful when those parameters are stated alongside the storage interval.
Detection in biological samples relies on mass spectrometry, typically liquid chromatography coupled to tandem mass spectrometry after peptide extraction and enrichment. Intact peptides can also be confirmed by high-resolution mass measurement together with fragmentation data. Detection windows in urine are short because the peptide is degraded by proteases and cleared quickly, and concentrations are low. Many jurisdictions treat the compound as a prohibited substance in sport, grouped with peptide hormones and related factors, while it is not an approved therapeutic product. Identity and purity statements therefore rest on certificates of analysis, ideally issued by an independent laboratory.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C38H68N10O14 | Calculated for the acetylated heptapeptide |
| Molecular weight | ~889 Da | Monoisotopic mass approximately 889.0 Da |
| Amino acid sequence | Ac-LKKTETQ | N-terminal acetylated seven-residue peptide |
| Appearance | White to off-white powder | Typically supplied as a lyophilized solid |
| Solubility class | Water-soluble | Peptides of this size generally dissolve in aqueous media |
Thymosin beta-4 itself is a natural peptide of 43 residues found in many cell types and body fluids. Its best-characterised function is binding and sequestering actin monomers, which influences cytoskeletal dynamics. The sequence most often associated with TB-500, LKKTETQ, corresponds to part of that actin-binding region. A different fragment, Ac-SDKP, is also derived from the same parent peptide and is studied in its own right, which is one reason discussions of thymosin fragments can become confusing. The two are structurally distinct and are not interchangeable.
Interest in the fragment grew during the 1990s and 2000s, when it moved from laboratory work into sports and supplement markets. Anti-doping bodies added thymosin beta-4 fragments to prohibited lists, and a small number of adverse analytical findings have been reported in competition testing. Published controlled human trials remain scarce. Most mechanistic evidence comes from cell culture and animal models, and those studies examine endpoints such as cell migration, wound closure and inflammation markers. That evidence supports research interest but does not establish clinical benefit, and broad regenerative claims should be read as unverified.
TB-500 is a short synthetic peptide sold under a trade name rather than a systematic chemical name. Suppliers usually describe it as a fragment of thymosin beta-4 and ship it as a lyophilised powder intended for laboratory use. Because the label is commercial, the exact sequence attributed to it is not fully consistent across catalogues, and some listings present a seven-residue peptide while others describe related fragments of similar length. It is not an approved medicine in any major jurisdiction, and it is handled as a research chemical.
The regulatory position is broadly consistent across major jurisdictions: no thymosin beta-4 fragment is an approved medicine, and laboratory material is commonly labelled as not intended for human consumption. Anti-doping rules in sport list thymosin beta-4 and its fragments among prohibited peptide hormones. Because these products travel through research-chemical channels rather than pharmaceutical supply chains, quality varies considerably between vendors. Independent testing of identity, purity and sterility is the only dependable check, and a certificate of analysis describes one batch rather than a supplier's whole catalogue.
Lyophilized peptide powder is normally held desiccated at −20 °C, with −80 °C used for longer storage periods. Allowing a sealed vial to reach room temperature before opening is standard practice, because condensation forming on cold powder introduces moisture. Once dissolved, solutions are typically kept cold and shielded from light. Repeated freeze-thaw cycles are avoided because they encourage aggregation and gradual loss of material. These conventions are general to synthetic peptides rather than unique to any one sequence.
Purity and identity are separate measurements and are often confused. Reverse-phase high-performance liquid chromatography, usually with ultraviolet detection near 214 nanometres, reports the share of total peak area belonging to the target compound. Mass spectrometry by electrospray or matrix-assisted laser desorption then checks whether the observed mass matches the expected sequence. Neither measurement alone shows that a vial holds the intended peptide. Peptide content, meaning the fraction of vial mass that is genuine peptide rather than counter-ion, water or residual acid, is reported separately and is frequently lower than the stated purity figure.
Research interest in thymosin beta-4 fragments centres on actin sequestration, cell migration and tissue repair models. Most published work uses cultured cells or animal wound and cardiac preparations, and findings are generally described as preliminary. No fragment of this protein has been approved as a therapeutic product by major regulators. Reviews of the field note inconsistent dosing, delivery routes and outcome measures across studies, which complicates direct comparison. The material is best understood as a laboratory reagent with an active but unresolved research literature.
TB-500 is a catalogue name applied to a synthetic peptide related to thymosin beta-4, an actin-binding protein found in most mammalian cells. Suppliers do not use the label consistently: some describe it as the full 43-residue protein, others as a short fragment from the actin-binding region, and others as a related tetrapeptide. Because the name is commercial rather than chemical, two products sold under it may not contain the same molecule. This naming ambiguity is the first point to check in any description of the material.
In development, the viability of the process on a semi-commercial scale has to be demonstrated. Trial quantities of the new fine chemical have to be manufactured for market development, clinical tests, and other requirements. The necessary data has to be generated in order to enable the engineering department to plan the modifications of the industrial-scale plant and in order to calculate production costs for the expected large-volume requirements. Both equipment and plant layout of the pilot plant reflect those of an industrial multipurpose plant, except for the size of reaction vessels (bench-scale laboratory ~10–60 liters; pilot plant ~100–2500 liters) and the degree of process automation. Before the process is ready for transfer to the industrial-scale plant, the following activities have to be completed: adaptation of the laboratory process to the constraints of a pilot plant, hazard and operability (HAZOP) analysis, and execution of demonstration batches. The main differences between laboratory synthesis and industrial scale production are shown in Table 4.
Caution, however, is generally prudent when doing this, as seizures, which are more likely to occur with clomipramine than every other tricyclic antidepressant besides maprotiline, become more and more of a risk beyond the normally-recommended upper-ceiling. At daily doses ≤ 250 mg, the incidence of seizures may be reliably estimated to be around the order of 0.48%. (All tricyclic antidepressants technically lower the seizure-threshold but this is only significant with amoxapine, maprotiline and, indeed, clomipramine.) Dose-increases between 25 mg and 150 mg, barring significant drug-drug interactions which may elevate clomipramine blood-levels, should be titrated in doses of 50 mg (25 mg in the case of panic disorder and 10 to 25 mg in the cases of premature ejaculation and narcoleptic cataplexy) and above 150 mg in 25 mg increments. Average optimal total daily doses for depression (whether mild or severe), premature ejaculation, cataplexy-narcolepsy, obsessive–compulsive disorder, panic disorder and trichotilomania respectively are (in milligrams) 150, 50, 25 - 75, 150 - 250, 50 - 150 and 150 - 200. Some consider the minimum optimally-therapeutic dose of clomipramine in obsessive-compulsive disorder, which often requires much higher levels of serotonergic concentration than other indications for these drugs, to be 200, rather than 150, milligrams per day. For premature ejaculation, clomipramine can be taken prn 3 to 5 hours before attempted sexual intercourse.
=== Antibacterial use === Tigecycline is used to treat different kinds of bacterial infections, including complicated skin and structure infections, complicated intra-abdominal infections and community-acquired bacterial pneumonia. Tigecycline is a glycylcycline antibiotic that covers MRSA and Gram-negative organisms:
Sources: en.wikipedia.org
Adrenaline has been implicated in feats of great strength, often occurring in times of crisis. For example, there are stories of a parent lifting part of a car when their child is trapped underneath, showcasing the ability of the body to endure under stress and highlighting the significant effects of adrenaline in unlocking extraordinary physical abilities.
=== Non-topical formulations for hair growth === Low-dose oral minoxidil started to emerge as a treatment for hair loss in 2015 and after with the work of Rodney Sinclair and other researchers. Subsequently, interest in and use of low-dose oral minoxidil for hair loss increased dramatically following the publication of an August 2022 New York Times article titled "An Old Medicine Grows New Hair for Pennies a Day, Doctors Say". New non-topical formulations of minoxidil for hair loss, such as extended-release oral minoxidil and sublingual minoxidil, have been developed in the 2020s towards formal approval for treatment of hair loss and with improved efficacy and/or tolerability profiles.
==== In the US ==== Blimpie (shaped like a blimp) – from the Hoboken, New Jersey–founded chain, Blimpie Po' boy – Louisiana Cosmo – Williamsport, Pennsylvania Zep (short for zeppelin) – Norristown, Pennsylvania
Peoples of the Altiplano had two large domesticated animals: llamas and alpacas. Among the food products made from the Peruvian camelids was sharqui, strips of freeze-dried meat, the origin of modern-day jerky. Another meat for royalty was that of the lizards known as Dicrodon holmbergi. It would be trapped as it attempted to consume the pods of Prosopis juliflora. After being trapped, it would be paralyzed and cooked until it was easily skinned. Afterwards, it was cooked for another ten minutes in heated sand and ashes then gutted, thus making it to be consumed immediately or preserved for up to a year. The meat of the common folk was the cuy, guinea pig. They were domesticated by 2000 BC and were easy to keep and multiplied rapidly. Guinea pigs were often cooked by stuffing them with hot stones. The entrails would often be used as an ingredient in soups along with potatoes, or made into a sauce. They could also be used for divination, which later brought them into disfavor by the Catholic Church. The Incas hunted game including the wild camelids vicuña and guanaco, whitetail deer, huemul deer and viscacha, a kind of chinchilla which was hunted with lassos. Hunting rights were controlled by the state and any meat would go into the state warehouses for storage. In massive royal hunts, hunting teams would force huge herds into enclosures, and there are reports of several thousand animals being caught in a single great hunt, including puma, bear, fox and deer. One mainstay of the Inca army and the general population was dried fish.
Sources: en.wikipedia.org
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
The N-terminal amino group and the C-terminal carboxylic acid can also be used as a site specific site by conjugation with aldehyde functional polymers. The techniques used to form first generation PEG derivatives are generally reacting the PEG polymer with a group that is reactive with hydroxyl groups, typically anhydrides, acid chlorides, chloroformates and carbonates. In the second generation PEGylation chemistry more efficient functional groups such as aldehyde, esters, amides etc. are made available for conjugation. As applications of PEGylation have become more and more advanced and sophisticated, there has been an increase in need for heterobifunctional PEGs for conjugation. These heterobifunctional PEGs are very useful in linking two entities, where a hydrophilic, flexible and biocompatible spacer is needed. Preferred end groups for heterobifunctional PEGs are maleimide, vinyl sulfones, pyridyl disulfide, amine, carboxylic acids and NHS esters. Third-generation pegylation agents, where the polymer has been branched, Y-shaped or comb-shaped are available and show reduced viscosity and lack of organ accumulation. Recently also enzymatic approaches of PEGylation have been developed, thus further expanding the conjugation tools. PEG-protein conjugates obtained by enzymatic methods are already in clinical use, for example: Lipegfilgrastim, Rebinyn, Esperoct.
Pseudomonas syringae is a rod-shaped, Gram-negative bacterium with polar flagella. As a plant pathogen, it can infect a wide range of species, and exists as over 50 different pathovars, all of which are available to researchers from international culture collections such as the NCPPB, ICMP, and others. Pseudomonas syringae is a member of the genus Pseudomonas, and based on 16S rRNA analysis, it has been placed in the P. syringae group. It is named after the lilac tree (Syringa vulgaris), from which it was first isolated. A phylogenomic analysis of 494 complete genomes from the entire Pseudomonas genus showed that P. syringae does not form a monophyletic species in the strict sense, but a wider evolutionary group that also included other species as well, such as P. avellanae, P. savastanoi, P. amygdali, and P. cerasi. Pseudomonas syringae tests negative for arginine dihydrolase and oxidase activity, and forms the polymer levan on sucrose nutrient agar. Many, but not all, strains secrete the lipopeptide plant toxin syringomycin, and it owes its yellow fluorescent appearance when cultured in vitro on King's B medium to production of the siderophore pyoverdin. Pseudomonas syringae also produces ice nucleation active (INA) proteins which cause water (in plants) to freeze at fairly high temperatures (−1.8 to −3.8 °C (28.8 to 25.2 °F)), resulting in injury. Since the 1970s, P. syringae has been implicated as an atmospheric biological ice nucleator, with airborne bacteria serving as cloud condensation nuclei.
== Management == Opioid use disorders typically require long-term treatment and care with the goal of reducing the person's risks and improving their long-term physical and psychological condition. First-line management involves the use of opioid replacement therapies, particularly methadone, naltrexone, morphine, hydromorphone, buprenorphine/naloxone (Suboxone), and diamorphine (heroin), which is the most effective treatment option of all drugs. Withdrawal management alone is strongly discouraged, because of its association with elevated risks of HIV and hepatitis C transmission, high rates of overdose deaths, and nearly universal relapse. This approach is seen as ineffective without plans for transition to long-term evidence-based addiction treatment, such as opioid agonist treatment. Though treatment reduces mortality rates, the first four weeks after treatment begins and the four weeks after treatment ceases are the riskiest times for drug-related deaths. These periods of increased vulnerability are significant because many of those in treatment leave programs during these periods. There is evidence that people with opioid use disorder who are dependent on pharmaceutical opioids may require a different management approach from those who take heroin.
Jenner sent a paper reporting his observations to the Royal Society in April 1797. It was not submitted formally and there is no mention of it in the Society's records. Jenner had sent the paper informally to Sir Joseph Banks, the Society's president, who asked Everard Home for his views. Reviews of his rejected report, published for the first time in 1999, were skeptical and called for further vaccinations. Additional vaccinations were performed and in 1798 Jenner published his work entitled An Inquiry into the Causes and Effects of the Variolae Vaccinae, a disease discovered in some of the western counties of England, particularly Gloucestershire and Known by the Name of Cow Pox. It was an analysis of 23 cases including several individuals who had resisted natural exposure after previous cowpox. It is not known how many Jenner vaccinated or challenged by inoculation with smallpox virus; e.g. Case 21 included 'several children and adults'. Crucially all of at least four whom Jenner deliberately inoculated with smallpox virus resisted it. These included the first and last patients in a series of arm-to-arm transfers. He concluded that cowpox inoculation was a safe alternative to smallpox inoculation, but rashly claimed that the protective effect was lifelong. This last proved to be incorrect. Jenner also tried to distinguish between 'True' cowpox which produced the desired result and 'Spurious' cowpox which was ineffective and/or produced severe reaction.
Sources: en.wikipedia.org
TB-500 is a synthetic heptapeptide corresponding to a fragment of thymosin beta-4. It is used in laboratory research and is not an approved drug.
No. Thymosin beta-4 is a 43-amino-acid protein, while TB-500 represents only a short N-terminal segment. The two should not be treated as interchangeable in experimental design.
It is often called a thymosin beta-4 fragment, Tβ4 fragment, or Ac-LKKTETQ. The name TB-500 is mainly a commercial or catalog label rather than a formal chemical name.
Sealed, dry and protected from light at reduced temperature is the usual laboratory convention. Allowing a cold vial to reach room temperature before opening limits condensation. Repeated opening exposes the powder to moisture and should be minimised.